WB; IH,Frozen; IH(P), Paraffin Immunohistochemistry (IHC) and Western Blotting (WB). A concentration of 1.0 μg/mL is recommended for WB. Rat HIF-2 alpha has a predicted length of 874 residues and MW of 97 kDa. A concentration of 0.5-1.0 μg/mL is recommended to detect the protein in formalin fixed and paraffin embedded tissues as well as formalin/acetone fixed frozen tissues. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
免疫原
A synthetic peptide (YNNCPPHSSLCGYKEPLLSCLIIMCEPIQHPSHMDIPLD) corresponding to a region (202-240) from rat Hypoxia-inducible factor-2 alpha. To enhance the immunological response, this peptide was coupled to carrier protein BSA.